PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_A522C62D1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 333aa    MW: 36438.8 Da    PI: 8.8911
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_A522C62D1.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.84.1e-32117172359
                            -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            DgynWrKYGqK+vkgsefprsYY+Ct+++Cpvk+kve++  d+++ ei+Y+geHnh+
  Traes_5BL_A522C62D1.1 117 DGYNWRKYGQKQVKGSEFPRSYYKCTHPTCPVKRKVETTV-DGQIAEIVYNGEHNHP 172
                            9***************************************.***************8 PP

2WRKY85.74.1e-27277330459
                            SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   4 gynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                             ++WrKYGqK v+g+ fprsYYrC++a+C+++k vers+ d + +++tYeg+Hnh 
  Traes_5BL_A522C62D1.1 277 AFRWRKYGQKAVNGNSFPRSYYRCSTARCNARKFVERSS-D-NSLVTTYEGKHNHV 330
                            69*************************************.4.567799*******6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.871110174IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-27111174IPR003657WRKY domain
SuperFamilySSF1182909.15E-25112174IPR003657WRKY domain
SMARTSM007741.2E-34115173IPR003657WRKY domain
PfamPF031061.7E-24117172IPR003657WRKY domain
SMARTSM007749.4E-27274331IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.1E-24275330IPR003657WRKY domain
PROSITE profilePS5081122.768275329IPR003657WRKY domain
SuperFamilySSF1182909.68E-21276329IPR003657WRKY domain
PfamPF031064.4E-22277329IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MQSQEKITPV KPVASRPFSS FTSFSKLLKD FTVTGSATIS SPGETVIVRR PKVTRFAPPP  60
SDLSAGIAAT MLQDAGLDTT HEKMVIDPEQ VVSCDQMTAF HDINKPIHGV KNRLSYDGYN  120
WRKYGQKQVK GSEFPRSYYK CTHPTCPVKR KVETTVDGQI AEIVYNGEHN HPQPHPPKKP  180
ASLASTEVVV PDAHGSNDAG AESQLGGCNL ALVSDPVAAA FKSSCDYVDE IGSTSPVYHC  240
NTSQKEKQTS ITNGLTSGEA APAFQSPTEC RSSGDAAFRW RKYGQKAVNG NSFPRSYYRC  300
STARCNARKF VERSSDNSLV TTYEGKHNHV QLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-181173291877Probable WRKY transcription factor 4
2lex_A1e-181173291877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8631230.0DQ863123.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 40 (WRKY40) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229417.11e-170PREDICTED: WRKY transcription factor 44-like
TrEMBLW5FG010.0W5FG01_WHEAT; Uncharacterized protein
STRINGMLOC_10687.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23252941
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.26e-49WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]